Log:
Assessments - 2, GPA: 4 ( )

Instruções de Operação Anthem Audio, Modelo MCA 30

Fabricante : Anthem Audio
Arquivo Tamanho: 268.3 kb
Arquivo Nome :
Língua de Ensino: en
Ir para baixar



Facilidade de uso


• Anthem and any related party assume no liability for the user’s failure to comply with requirements. 1.2 IN-USE NOTICES • Disconnect the power cord before connecting or disconnecting any components. • Do not remove the top cover. • Do not modify the product. 2. CONNECTIONS AND OPERATION 2.1 INPUT CONNECTIONS Balanced XLR connection offers the highest transmission quality, particularly over long cable lengths, because it rejects noise and hum pickup. Note that if an RCA plug is inserted into the RCA jack, that channel’s XLR input is disabled. If your preamplifier does not have XLR outputs, use the Single-Ended RCA inputs. Do not use ‘RCA-compatible’ connectors that have a hollow center pin with a hole at the tip – inserting them into the MCA amplifier’s RCA jacks can cause internal damage. 2.2 SPEAKER CONNECTIONS Dependingontheleveloftheinputsignal,thevoltageattheoutputscanbehighenoughtocauseelectricshock–besurethatpoweristurnedoffwhenconnectingordisconnectinganything.Aswell,besurethatthespeakersareratedforusewiththisamplifier–anoverdrivenspeakercanposeafirehazard. Connectthered(+)connectiononthespeakertothered(+)bindingpostontheappropriateamplifierchannel,andtheblack(–)connectiononthespeakertotheblack(–)bindingpostonthesameamplifierchannel,usingcablethatisinsulatedtohandlethemaximumoutputoftheamplifier.Donotovertightenthebindingpostsasthismaycausedamage.Eachbindingpostacceptsaconnectionfromonespeaker. 2.3ONMODESWiththethree-wayswitchlocatedontherearpanel,youcansetthewaytheamplifieristurnedonandoff. TouseTrigger-On,connectastandard3.5mm(.125”)monominiplugcablebetweentheamplifierandthepreamplifierorcontrolcomponent.Onceallotherconnectionsaremade,connectthepowercordtotheamplifierandthenthewalloutlet.Some‘clicks’shouldbeheardfromrelaysinsidetheamplifierafewsecondsafterpoweristurnedon. Manual-On: Wheninthisposition,theamplifieristurnedon/offviathepowerbuttononthefrontpanel. Trigger-On: Thisfeatureallowstheamplifiertobeturnedonoroffremotelyviathetrigger.The3.5mm(.125”)mini-jackINPUTreceivespower(5-24volts,ACorDC)fromanupstreamcomponentorsystemcontroller.Thesametriggersignalcanbelinkedtoother components through the OUTPUT. When using Trigger mode, leave the front power button in the ‘on’ position. Auto-On: This feature also eliminates the need to manually operate the power button. Auto-On turns the amplifier on whenever it senses an input signal on any channel, and switches off 20 minutes after the input signal stops. The power button on the front panel must be left ‘on’. 2-Color LED: In Manual mode, the LED on the front panel is lit blue when the amplifier is on. In Auto or Trigger mode, the LED is lit red to indicate standby mode, and blue to indicate operate mode. Note: The amplifier is equipped with a thermal shut off feature. If it overheats, the affected channel will remain off until the temperature falls below the shut off threshold. 2. CONNECTIONS AND OPERATION continued … 2.4 REAR PANEL LAYOUT WARNING.VA MCA 20WARNINGRISK OF HAZARDOUS ENERGY! MAKE PROPER SPEAKER CONNECTIONS. SEE OPERATING MANUAL BEFORE USING. VA MCA 30 MCA 20 MCA 30 VA MCA 50WARNING. 12345786 MCA 50 1 – Fuses (one in MCA 20/30, two in MCA 50) 5 – On-Mode (Trigger / Manual / Auto) 2 – Single-Ended RCA Inputs 6 – Speaker Binding Posts 3 – Trigger Input and Output 7 – Power Cord Socket 4 – Balanced XLR Inputs 8 – Chassis Ground SPECIFICATIONS Power Output (Continuous RMS, 20 Hz to 20 kHz, <1.0% THD) MCA 20: One Channel Driven (8 .,4 .,2 .). . . . . . . . . . . . . . . . . . . . . . 225 W, 370 W, 535 W All Channels Driven (8 .,4 .,2 .). . . . . . . . . . . . . . . . . . . . . . 200 W, 300 W, 410 W MCA 30: One Channel Driven (8 .,4 .,2 .). . . . . . . . . . . . . . . . . . . . . . 225 W, 375 W, 550 W All Channels Driven (8 .,4 .,2 .). . . . . . . . . . . . . . . . . . . . . . 180 W, 265 W, 340 W MCA 50: One Channel Driven (8 .,4 .,2 .). . . . . . . . . . . . . . . . . . . . . . 225 W, 370 W, 535 W All Channels Driven (8 .,4 .,2 .). . . . . . . . . . . . . . . . . . . . . 180 W, 265 W, 340 W* *Special Test Conditions Required for 2 . Frequency Response . . . . . . . . . . . . . . . . . . . . . . . 20 Hz to 20 kHz (+0, -0.15 dB), 5 Hz to 100 kHz (+0, -2 dB) THD+N . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0.0015% at 1 kHz, 0.03% at 20 kHz (100 W into 8 .) Power Bandwidth . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Hz to 80 kHz (+0, -3 dB, 200 W into 8 .) Slew Rate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 V/.s Headroom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.45 dB (8 .), 2.3 dB (4 .) Input Sensitivity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.5 Vrms in for 225 W out into 8 . Input Impedance . . . . . . . . . . . . . . . . . . . . . . ...

Este manual também é adequado para os modelos :
receptor e amplificador - MCA 20, MCA 30, MCA 50 (268.3 kb)
receptor e amplificador - MCA 50 (268.3 kb)

Escreva a sua própria avaliação do dispositivo



Mensagem
Seu nome :
Introduza os dois dígitos :
capcha





categorias